General Information

  • ID:  hor006950
  • Uniprot ID:  P13501
  • Protein name:  C-C motif chemokine 5
  • Gene name:  cgbb
  • Organism:  Homo sapiens
  • Family:  Intercrine beta (chemokine CC) family
  • Source:  Human
  • Expression:  Expressed in the follicular fluid
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005737 cytoplasm; GO:0005576 extracellular region; GO:0005615 extracellular space
  • GO BP:  GO:0030298 receptor signaling protein tyrosine kinase activator activity; GO:0042379 chemokine receptor binding; GO:0031730 CCR5 chemokine receptor binding; GO:0031729 CCR4 chemokine receptor binding; GO:0031726 CCR1 chemokine receptor binding; GO:0048020 CCR chemokine receptor binding; GO:0046817 chemokine receptor antagonist activity; GO:0042056 chemoattractant activity; GO:0042802 identical protein binding; GO:0008009 chemokine activity; GO:0004672 protein kinase activity; GO:0016004 phospholipase activator activity; GO:0004435 phosphatidylinositol phospholipase C activity; GO:0042803 protein homodimerization activity
  • GO CC:  GO:0045785 positive regulation of cell adhesion; GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:0031584 activation of phospholipase D activity; GO:0033634 positive regulation of cell-cell adhesion mediated by integrin; GO:0031328 positive regulation of cellular biosynthetic process; GO:0050679 positive regulation of epithelial cell proliferation; GO:0045745 positive regulation of G protein-coupled receptor signaling pathway; GO:0009615 response to virus; GO:0009636 response to toxic substance; GO:0050863 regulation of T cell activation; GO:0050796 regulation of insulin secretion; GO:0002676 regulation of chronic inflammatory response; GO:0006816 calcium ion transport; GO:0045070 positive regulation of viral genome replication; GO:0045948 positive regulation of translational initiation; GO:0042102 positive regulation of T cell proliferation; GO:20

Sequence Information

  • Sequence:  PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
  • Length:  67
  • Propeptide:  MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
  • Signal peptide:  MKVSAAALAVILIATALCAPASA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA